PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009777081.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 305aa    MW: 34878.7 Da    PI: 5.4637
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009777081.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.52.2e-11175219549
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                     kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  ++
  XP_009777081.1 175 KRIKRILANRQSAQRSRVRKLQYISELERSVTTLQAEVSVLSPRV 219
                     899*********************************988776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-13171235IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.576173225IPR004827Basic-leucine zipper domain
PfamPF001708.0E-10175219IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.21E-11175229No hitNo description
Gene3DG3DSA:1.20.5.1701.7E-13175226No hitNo description
CDDcd147031.73E-21176226No hitNo description
PROSITE patternPS000360178193IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MAHLPPRVPN MTPNWPDFSH HQKIDTTTTA IHNPSWVDEF LDFSSTKRGS HRRSISDSIA  60
FLEAPMVEEC RRLSTPGKTT GSEFERFDDE QLMSMFNDDI ANPSSPSDNN SINEEKKMST  120
IISTDDQEMQ QQQQQQQLKT EPEEVESSCK SDEQTASDQH ATADNNSSEK IVDPKRIKRI  180
LANRQSAQRS RVRKLQYISE LERSVTTLQA EVSVLSPRVA FLDHQRLVLN VDNSVLKQRI  240
AALAQDKIFK DAHQEALKRE IERLRQIYYQ QNLKKMEDEI PTTQSKSQPA AADANASEQK  300
EQLVN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009777081.10.0PREDICTED: basic leucine zipper 61-like
RefseqXP_016468123.10.0PREDICTED: basic leucine zipper 61-like
SwissprotQ9M2K41e-111BZP61_ARATH; Basic leucine zipper 61
TrEMBLM1AJT91e-154M1AJT9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000242891e-154(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17752465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.21e-103bZIP family protein